PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 713aa    MW: 79078 Da    PI: 6.9295
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606250.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-182677556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++t++q+++Le++F+++++p+ ++r +L+k l+L  rq+k+WFqNrR++ k
  XP_009606250.1 26 HRHTAHQIQRLEAVFKECPHPDDKSRLQLSKDLSLAPRQIKFWFQNRRTQLK 77
                    689*********************************************9987 PP

2START1723.8e-542194442206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a   ++el+++ + +ep+W+ks     + ++ d + q+f+++++        +ea+r+sgvv+m+   lv+ ++d + +W e ++    ka t+
  XP_009606250.1 219 IAGNSMEELIRLLQTNEPLWTKSTtdgrDVLDLDSYNQIFPRANSslknpnVCIEASRDSGVVIMNGLALVNMFMDAN-KWVEFFPtvvsKARTI 312
                     567899*******************99999************999***99999*************************.*******9******** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     e+is g      ++lqlm+ elqalsplvp R + f+R+++q ++g+w+ivdvS d  q+++  ss+ ++++lpSg+li++++ng+skvtwvehv
  XP_009606250.1 313 ERISCGvmggrsSTLQLMYEELQALSPLVPmRQSFFLRFCQQIEQGSWAIVDVSYDIIQENQYPSSSCKVHRLPSGCLIQDMPNGYSKVTWVEHV 407
                     ********************************************************9999988999***************************** PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     +++++   h l+r l++sg+a+ga +w+  lqr+ce+
  XP_009606250.1 408 EVEEKGLiHKLYRDLIHSGMAFGAERWLGSLQRLCER 444
                     **987555***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-19779IPR009057Homeodomain-like
SuperFamilySSF466894.6E-18778IPR009057Homeodomain-like
PROSITE profilePS5007116.8921979IPR001356Homeobox domain
SMARTSM003893.8E-172083IPR001356Homeobox domain
CDDcd000863.82E-172179No hitNo description
PfamPF000463.5E-162677IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084846.852209447IPR002913START domain
SuperFamilySSF559611.33E-34210446No hitNo description
CDDcd088751.34E-108213443No hitNo description
SMARTSM002342.2E-43218444IPR002913START domain
PfamPF018525.2E-46219444IPR002913START domain
SuperFamilySSF559612.64E-18465677No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MEYGVTSSSS GGVDASETHR KKKRFHRHTA HQIQRLEAVF KECPHPDDKS RLQLSKDLSL  60
APRQIKFWFQ NRRTQLKSQL ERADNCALRA ENDRIRRENI AIREAIKNVI CPSCGGPSVT  120
EDSYFDEQKM RMENMQLKEE LDKISSIAAK YIGRPISQLP PVQPIHPSSL NLMSMSSFGL  180
TGPSLDLHLL PGSSMSTLPS LPFPTLNISD MDKSLMADIA GNSMEELIRL LQTNEPLWTK  240
STTDGRDVLD LDSYNQIFPR ANSSLKNPNV CIEASRDSGV VIMNGLALVN MFMDANKWVE  300
FFPTVVSKAR TIERISCGVM GGRSSTLQLM YEELQALSPL VPMRQSFFLR FCQQIEQGSW  360
AIVDVSYDII QENQYPSSSC KVHRLPSGCL IQDMPNGYSK VTWVEHVEVE EKGLIHKLYR  420
DLIHSGMAFG AERWLGSLQR LCERYACLMV SGKSSRELGR VIPSPEGKKS MMKLAQRMVS  480
NFCASINPSN GHQWNAISGL DEFEIRATLQ KSIDPGQPNG VIISAASTIW LPVPSQHIFN  540
FLRDEMTRPQ WDVLSNQNPV QEVAHIANGS HSGNCISVLR AYNTSQNNML ILQESCIDSS  600
GSLVIYSPVD LPSINIAMSG EDTTYIPLLP SGFTISPDGR QGQRSNEASY SSTNNGTMGD  660
NGSEGSLVTV VFQILVSSLS SSAKMSPESV STVNNLIGNT IHQIKVALNC STS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-126HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606250.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLM1CK980.0M1CK98_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000693120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11